Rabbit Anti-PILRA Polyclonal Antibody-Advanced Biomart

Cat#:FPA-32301P;Product Name:Rabbit Anti-PILRA Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to a region within N-terminal aa 51-100 (IPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFL N) of Human PILRA isoform 3 (NP_840057). Note: this aminoacid sequence is identical in all 4 isoforms of human PILRA. ;Species Reactivity:Human;Isotype:IgG;Application:WB;Storage Buffer:Preservative: None Constituents: 2% Sucrose, PBS;Storage Procedures:Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.;

Home > Products > Primary Antibodies >

Rabbit Anti-PILRA Polyclonal Antibody Online Inquiry

Cat#:	FPA-32301P
Product Name:	Rabbit Anti-PILRA Polyclonal Antibody
Formulation:	Liquid
Host Species:	Rabbit
Immunogen:	Synthetic peptide corresponding to a region within N-terminal aa 51-100 (IPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFL N) of Human PILRA isoform 3 (NP_840057). Note: this aminoacid sequence is identical in all 4 isoforms of human PILRA.
Species Reactivity:	Human
Isotype:	IgG
Application:	WB
Storage Buffer:	Preservative: None Constituents: 2% Sucrose, PBS
Storage Procedures:	Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.