Cat#:FPA-25370P;Product Name:Goat Anti-MCP1 Polyclonal Antibody;Formulation:Liquid;Host Species:Goat ;Immunogen:Recombinant full length protein corresponding to Cow MCP1 aa 24-99. Sequence: QPDAINSQVACCYTFNSKKISMQRLMNYRRVTSSKCPKEAVIFKTILGKE LCADPKQKWVQDSINYLNKKNQTPKP ;Species Reactivity:Cow Predicted to work with: Pig;Isotype:IgG;Application:ELISA, WB;Storage Buffer:Preservative: 0.09% Sodium azide Constituents: 0.2% BSA, 99% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles. Store In the Dark.;