Cat#:FPA-13206P;Product Name:Rabbit Anti-eIF4ENIF1 Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human eIF4ENIF1 aa 60-95 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Sequence: VWDPEKWHASLYPASGRSSPVESLKKELDTDRPSLV ;Species Reactivity:Human Predicted to work with: Mouse, Rat;Isotype:IgG;Application:IHC-P;Storage Buffer:Preservative: 0.09% Sodium azide Constituents: 50% Glycerol, 1% BSA Aqueous buffered solution;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;