Rabbit Anti-eIF4B Polyclonal Antibody-Advanced Biomart

Cat#:FPA-13180P;Product Name:Rabbit Anti-eIF4B Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide within Mouse eIF4B aa 301-350 (C terminal). The exact sequence is proprietary. Sequence: DGGSRDHWKDLDRKDGKKDQDSRSAPEPKKPEENPASKFSSASKYAALSV ;Species Reactivity:Mouse Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Human;Isotype:IgG;Application:WB;Storage Buffer:Constituents: 98% PBS, 2% Sucrose;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;

Home > Products > Primary Antibodies >

Rabbit Anti-eIF4B Polyclonal Antibody Online Inquiry

Cat#:	FPA-13180P
Product Name:	Rabbit Anti-eIF4B Polyclonal Antibody
Formulation:	Liquid
Host Species:	Rabbit
Immunogen:	Synthetic peptide within Mouse eIF4B aa 301-350 (C terminal). The exact sequence is proprietary. Sequence: DGGSRDHWKDLDRKDGKKDQDSRSAPEPKKPEENPASKFSSASKYAALSV
Species Reactivity:	Mouse Predicted to work with: Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Human
Isotype:	IgG
Application:	WB
Storage Buffer:	Constituents: 98% PBS, 2% Sucrose
Storage Procedures:	Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.