Rabbit Anti-DDX11 Polyclonal Antibody-Advanced Biomart

Cat#:FPA-11280P;Product Name:Rabbit Anti-DDX11 Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Recombinant fragment corresponding to Human DDX11 aa 69-127. Sequence: KREEEARLLETGTGPLHDEKDESLCLSSSCEGAAGTPRPAGEPAWVTQFV QKKEERDLV ;Species Reactivity:Human;Isotype:IgG;Application:IHC-P, ICC/IF;Storage Buffer:pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;

Home > Products > Primary Antibodies >

Rabbit Anti-DDX11 Polyclonal Antibody Online Inquiry

Cat#:	FPA-11280P
Product Name:	Rabbit Anti-DDX11 Polyclonal Antibody
Formulation:	Liquid
Host Species:	Rabbit
Immunogen:	Recombinant fragment corresponding to Human DDX11 aa 69-127. Sequence: KREEEARLLETGTGPLHDEKDESLCLSSSCEGAAGTPRPAGEPAWVTQFV QKKEERDLV
Species Reactivity:	Human
Isotype:	IgG
Application:	IHC-P, ICC/IF
Storage Buffer:	pH: 7.2 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol
Storage Procedures:	Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.