• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Rabbit Anti-CEP55 Polyclonal Antibody Online Inquiry

Cat#:FPA-8255P
Product Name:Rabbit Anti-CEP55 Polyclonal Antibody
Formulation: Liquid
Host Species: Rabbit
Immunogen: Synthetic peptide within Human CEP55 aa 160-195 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Sequence: FNSSINNIHEMEIQLKDALEKNQQWLVYDQQREVYV
Species Reactivity: Human Predicted to work with: Mouse, Rat
Isotype: IgG
Application: IHC-P
Storage Buffer: Preservative: 0.09% Sodium azide Constituents: 50% Glycerol, 1% BSA
Storage Procedures: Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.

Online Inquiry

refresh