Rabbit Anti-Annexin A11 Polyclonal Antibody-Advanced Biomart

Cat#:FPA-2263P;Product Name:Rabbit Anti-Annexin A11 Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide corresponding to a region within C terminal aa 328-377( TSGHFQRLLISLSQGNRDESTNVDMSLVQRDVQELYAAGENRLGTDESKF ) of Mouse Annexin A11 (NP_038497). ;Species Reactivity:Mouse Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Zebrafish;Isotype:IgG;Application:WB;Storage Buffer:Constituents: 2% Sucrose, 97% PBS;Storage Procedures:Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.;

Home > Products > Primary Antibodies >

Rabbit Anti-Annexin A11 Polyclonal Antibody Online Inquiry

Cat#:	FPA-2263P
Product Name:	Rabbit Anti-Annexin A11 Polyclonal Antibody
Formulation:	Liquid
Host Species:	Rabbit
Immunogen:	Synthetic peptide corresponding to a region within C terminal aa 328-377( TSGHFQRLLISLSQGNRDESTNVDMSLVQRDVQELYAAGENRLGTDESKF ) of Mouse Annexin A11 (NP_038497).
Species Reactivity:	Mouse Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Human, Zebrafish
Isotype:	IgG
Application:	WB
Storage Buffer:	Constituents: 2% Sucrose, 97% PBS
Storage Procedures:	Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.