Cat#:FPA-249P;Product Name:Rabbit Anti-AADAC Polyclonal Antibody;Formulation:Liquid;Host Species:Rabbit ;Immunogen:Synthetic peptide within Human AADAC aa 230-280 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. Sequence: PSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFK F ;Species Reactivity:Human Predicted to work with: Mouse, Rat;Isotype:IgG;Application:IHC-P;Storage Buffer:Preservative: 0.09% Sodium azide Constituents: 50% Glycerol, 1% BSA;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid repeated freeze/thaw cycles.;