Cat#:FPA-15333M;Product Name:Mouse Anti-NIFK Monoclonal Antibody;Formulation:Liquid;Host Species:Mouse ;Immunogen:Recombinant fragment corresponding to Human NIFK AA 181-261. Sequence: IDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDS QGPTPVCTPTFLERRKSQVAELNDDDKDDEI ;Species Reactivity:Human;Clone#:BK1139;Isotype:IgG2a;Application:IHC-P, ICC/IF;Positive control:Human fallopian tube, Human cervix, Human endometrium, Human prostate, Human rectum and Human kidney tissues; HeLa, A431, MCF7, U2OS and U251 cell lines.;Storage Buffer:pH: 7.20 Preservative: 0.02% Sodium azide Constituents: 59% PBS, 40% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;