Cat#:FPA-15325M;Product Name:Mouse Anti-Niemann Pick C1 Monoclonal Antibody;Formulation:Liquid;Host Species:Mouse ;Immunogen:Recombinant fragment corresponding to Human Niemann Pick C1 AA 34-174. (Expressed in E.coli). Sequence: AYGDKRYNCEYSGPPKPLPKDGYDLVQELCPGFFFGNVSLCCDVRQLQTL KDNLQLPLQFLSRCPSCFYNLLNLFCELTCSPRQSQFLNVTATEDYVDPV TNQTKTNVKELQYYVGQSFANAMYNACRDVEAPSSNDKALG ;Species Reactivity:Human Predicted to work with: Mouse, Pig;Clone#:7C19A5;Isotype:IgG1;Application:IHC-P, WB;Positive control:Human Niemann Pick C1 recombinant protein; Niemann Pick C1 (aa: 34-174)-hIgGFc transfected HEK293 cell lysate; Human striated muscle and esophageal cancer tissues.;Storage Buffer:Preservative: 0.05% Sodium azide Constituent: 99% PBS Contains 0.5% protein stabilizer (Amino acid =85%, pH(1% water solution) =7.0~7.5, Water =2%, As(mg/kg) =0.5, Pb(mg/kg) =0.1).;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;