Cat#:FPA-15249M;Product Name:Rat Anti-Neutrophil Elastase Monoclonal Antibody;Formulation:Lyophilised:Reconstitute the antibody with 500 µl sterile PBS and the final concentration is 200 µg/ml. Reconstituted antibody can also be aliquoted and stored frozen at <-20 for at least for six months without detectable loss of activity. Avoid repeated ;Host Species:Rat ;Immunogen:Recombinant full length protein corresponding to Mouse Neutrophil Elastase AA 1-260. Sequence: MALGRLSSRTLAAMLLALFLGGPALASEIVGGRPARPHAWPFMASLQRRG GHFCGATLIARNFVMSAAHCVNGLNFRSVQVVLGAHDLRRQERTRQTFSV QRIFENGFDPSQLLNDIVIIQLNGSATINANVQVAQLPAQGQGVGDRTPC LAMGWGR;Species Reactivity:Mouse;Clone#:QL9373-3V18;Isotype:IgG2;Application:WB;Positive control:Mouse bone marrow tissue lysate;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;