Cat#:FPA-15186M;Product Name:Mouse Anti-Neuraminidase Monoclonal Antibody;Formulation:Liquid;Host Species:Mouse ;Immunogen:Recombinant fragment corresponding to Human Neuraminidase AA 48-315. Sequence: ENDFGLVQPLVTMEQLLWVSGRQIGSVDTFRIPLITATPRGTLLAFAEAR KMSSSDEGAKFIALRRSMDQGSTWSPTAFIVNDGDVPDGLNLGAVVSDVE TGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFA PGPGSGIQKQREPRKGRLIVCGH;Species Reactivity:Human Predicted to work with: Mouse, Rat, Cow, Pig, Orangutan;Clone#:2C3;Isotype:IgG2a;Application:WB, IHC-P;Positive control:Lysate from HEK293T cells transfected with Neuraminidase cDNA; Human breast carcinoma, colon carcinoma, kidney, liver, liver carcinoma, lung carcinoma, pancreas and bladder carcinoma tissues.;Storage Buffer:pH: 7.30 Preservative: 0.02% Sodium azide Constituents: 48% PBS, 50% Glycerol, 1% BSA;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;