Cat#:FPA-15176M;Product Name:Mouse Anti-NeuN Monoclonal Antibody;Formulation:Liquid;Host Species:Mouse ;Immunogen:Recombinant fragment corresponding to Human NeuN AA 1-100 (N terminal). Expressed in and purified from E. coli. Sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTP AQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR ;Species Reactivity:Mouse, Rat, Goat, Chicken, Cow, Cat, Dog, Human, Pig, Sea urchin, Common marmoset;Clone#:1A6;Isotype:IgG2a;Application:IHC-FoFr, IHC-P, WB, ICC/IF;Positive control:Rat brain extract; Rat brain neural culture. This antibody gave a positive result in IHC in the following FFPE tissue: Human hippocampus.;Storage Buffer:Preservative: 10mM Sodium Azide Constituents: PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.;