• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Mouse Anti-NeuN Monoclonal Antibody Online Inquiry

Cat#:FPA-15176M
Product Name:Mouse Anti-NeuN Monoclonal Antibody
Formulation: Liquid
Host Species: Mouse
Immunogen: Recombinant fragment corresponding to Human NeuN AA 1-100 (N terminal). Expressed in and purified from E. coli. Sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTP AQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR
Species Reactivity: Mouse, Rat, Goat, Chicken, Cow, Cat, Dog, Human, Pig, Sea urchin, Common marmoset
Clone#: 1A6
Isotype: IgG2a
Application: IHC-FoFr, IHC-P, WB, ICC/IF
Positive control: Rat brain extract; Rat brain neural culture. This antibody gave a positive result in IHC in the following FFPE tissue: Human hippocampus.
Storage Buffer: Preservative: 10mM Sodium Azide Constituents: PBS
Storage Procedures: Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.

Online Inquiry

refresh