Cat#:FPA-1509M;Product Name:Mouse Anti-Aurora B Monoclonal Antibody;Formulation:Liquid;Host Species:Mouse ;Immunogen:Recombinant full length protein corresponding to Human Aurora B AA 1-344. NP_004208. Purified from E. coli. Sequence: MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPT AAPGQKVMENSSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSH FIVALKVLFKSQIEKEGVEHQLRREIEIQAHLHHP;Species Reactivity:Human Predicted to work with: Cow, Pig;Clone#:ZS1A1;Isotype:IgG2b;Application:ICC/IF;Positive control:HeLa cells;Storage Buffer:pH: 7.4 Preservative: 0.02% Sodium azide Constituents: PBS, 10% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;