Cat#:FPA-15025M;Product Name:Mouse Anti-NCS1 Monoclonal Antibody;Formulation:Liquid;Host Species:Mouse ;Immunogen:Recombinant full length protein corresponding to Human NCS1 AA 1-190. Purified from E.coli. Sequence: MGKSNSKLKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQK IYKQFFPFGDPTKFATFVFNVFDENKDGRIEFSEFIQALSVTSRGTLDEK LRWAFKLYDLDNDGYITRNEMLDIVDAIYQMVGNTVELPEEENTPEKRVD ;Species Reactivity:Human Predicted to work with: Mouse, Rat, Chicken, Cow, Xenopus laevis, Orangutan;Clone#:ZS11A7;Isotype:IgG1;Application:WB, Flow Cyt;Positive control:WB: 293T, K562, LaCap and HeLa cell lysates. FACS: HeLa and A549 cells.;Storage Buffer:pH: 7.40 Preservative: 0.02% Sodium azide Constituents: PBS, 10% Glycerol;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;