Cat#:FPA-14777M;Product Name:Mouse Anti-Myeloid Marker Monoclonal Antibody;Formulation:Liquid;Host Species:Mouse ;Immunogen:Recombinant full length protein corresponding to Human Myeloid Marker AA 1-322. NCBI Accession No. 380906. Sequence: MPVTVTRTTITTTTTSSSGLGSPMIVGSPRALTQPLGLLRLLQLVSTCVA FSLVASVGAWTGSMGNWSMFTWCFCFSVTLIILIVELCGLQARFPLSWRN FPITFACYAALFCLSASIIYPTTYVQFLSHGRSRDH;Species Reactivity:Human Predicted to work with: Macaque monkey, Orangutan;Clone#:LXZCL861;Application:IHC-P;Positive control:HL60 cells. Tonsil and lymph node tissues.;Storage Buffer:Preservative: 0.05% Sodium azide Constituents: 0.05% BSA, 99% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;