• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Mouse Anti-MUC2 Monoclonal Antibody Online Inquiry

Cat#:FPA-14631M
Product Name:Mouse Anti-MUC2 Monoclonal Antibody
Formulation: Liquid
Host Species: Mouse
Immunogen: Synthetic peptide corresponding to Human MUC2 AA 1896-1922 conjugated to keyhole limpet haemocyanin. Sequence: KYPTTTPISTTTTTMVTPTPTPTGTQTPTTT
Species Reactivity: Human
Clone#: ROL42
Isotype: IgG1
Application: IHC-P, ICC/IF, Flow Cyt
Positive control: Human colon carcinoma tissue;LS174T cells.
Storage Procedures: Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

Online Inquiry

refresh