Mouse Anti-MUC2 Monoclonal Antibody-Advanced Biomart

Cat#:FPA-14631M;Product Name:Mouse Anti-MUC2 Monoclonal Antibody;Formulation:Liquid;Host Species:Mouse ;Immunogen:Synthetic peptide corresponding to Human MUC2 AA 1896-1922 conjugated to keyhole limpet haemocyanin. Sequence: KYPTTTPISTTTTTMVTPTPTPTGTQTPTTT ;Species Reactivity:Human;Clone#:ROL42;Isotype:IgG1;Application:IHC-P, ICC/IF, Flow Cyt;Positive control:Human colon carcinoma tissue;LS174T cells.;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;

Home > Products > Primary Antibodies >

Mouse Anti-MUC2 Monoclonal Antibody Online Inquiry

Cat#:	FPA-14631M
Product Name:	Mouse Anti-MUC2 Monoclonal Antibody
Formulation:	Liquid
Host Species:	Mouse
Immunogen:	Synthetic peptide corresponding to Human MUC2 AA 1896-1922 conjugated to keyhole limpet haemocyanin. Sequence: KYPTTTPISTTTTTMVTPTPTPTGTQTPTTT
Species Reactivity:	Human
Clone#:	ROL42
Isotype:	IgG1
Application:	IHC-P, ICC/IF, Flow Cyt
Positive control:	Human colon carcinoma tissue;LS174T cells.
Storage Procedures:	Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.