Cat#: | FPA-14631M |
Product Name: | Mouse Anti-MUC2 Monoclonal Antibody |
Formulation: | Liquid |
Host Species: | Mouse |
Immunogen: | Synthetic peptide corresponding to Human MUC2 AA 1896-1922 conjugated to keyhole limpet haemocyanin. Sequence: KYPTTTPISTTTTTMVTPTPTPTGTQTPTTT |
Species Reactivity: | Human |
Clone#: | ROL42 |
Isotype: | IgG1 |
Application: | IHC-P, ICC/IF, Flow Cyt |
Positive control: | Human colon carcinoma tissue;LS174T cells. |
Storage Procedures: | Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. |