Cat#:FPA-14468M;Product Name:Mouse Anti-MRRF Monoclonal Antibody;Formulation:Liquid;Host Species:Mouse ;Immunogen:Recombinant full length protein corresponding to Human MRRF AA 56-262. Isoform 1, expressed in E.coli. Sequence: MALGLKCFRMVHPTFRNYLAASIRPVSEVTLKTVHERQHGHRQYMAYSAV PVRHFATKKAKAKGKGQSQTRVNINAALVEDIINLEEVNEEMKSVIEALK DNFNKTLNIRTSPGSLDKIAVVTADGKLALNQISQISMKS;Species Reactivity:Human Predicted to work with: Mouse, Rat, Cow;Clone#:ZS6C19;Isotype:IgG1;Application:WB;Positive control:HepG2, 293T or HeLa lysate.;Storage Buffer:pH: 7.40 Preservative: 0.01% Sodium azide Constituents: 10% Glycerol, 89% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;