Cat#: | FPA-11269M |
Product Name: | Mouse Anti-HuD Monoclonal Antibody |
Formulation: | Liquid |
Host Species: | Mouse |
Immunogen: | Recombinant fragment corresponding to Human HuD AA 312-381. Sequence: VLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGY RLGDRVLQVSFKTNKAHKS |
Species Reactivity: | Human |
Clone#: | 27EF281 |
Isotype: | IgG1 |
Application: | WB, IHC-P |
Storage Buffer: | Preservative: None PBS, pH 7.2 |
Storage Procedures: | Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |