Cat#:FPA-11133M;Product Name:Mouse Anti-Hsp60 Monoclonal Antibody;Formulation:Liquid;Host Species:Mouse ;Immunogen:Recombinant full length protein corresponding to Human Hsp60 AA 1-573. Sequence: MLRLPTVFRQMRPVSRVLAPHLTRAYAKDVKFGADARALMLQGVDLLADA VAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQD VANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDA VIAELKKQSKPVTTPEEIAQV;Species Reactivity:Human Predicted to work with: Mouse, Rat, Sheep, Rabbit, Chicken, Cow, Dog, Pig, Monkey, Chinese hamster, Orangutan;Clone#:GROC1/679;Isotype:IgG1;Application:IHC-P, Flow Cyt, ICC/IF, WB;Positive control:IHC-P: Human bladder, lung and renal cell carcinoma tissues; Human pancreas tissue.;Storage Buffer:Preservative: 0.05% Sodium azide Constituents: 99% PBS, 0.05% BSA;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;