Cat#:FPA-10892M;Product Name:Mouse Anti-HNF-4-alpha Monoclonal Antibody;Formulation:Liquid;Host Species:Mouse ;Immunogen:Recombinant fragment corresponding to Human HNF-4-alpha AA 3-49. Sequence: MADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSAL ;Species Reactivity:Mouse, Rat, Cow, Human Predicted to work with: Pig;Clone#:J8117;Isotype:IgG2a;Application:WB, ELISA, IP, IHC-P, ICC/IF, Flow Cyt, ChIP;Positive control:Human liver hepatocytes and rat intestine epithelial cell.;Storage Buffer:Preservative: 0.1% Sodium azide Physiological saline.;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;