Cat#:FPA-10837M;Product Name:Mouse Anti-HMGB1 Monoclonal Antibody;Formulation:Liquid;Host Species:Mouse ;Immunogen:Recombinant fragment corresponding to Human HMGB1 AA 1-200. Sequence: MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWK TMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPS AFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAK LKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSK;Species Reactivity:Human Predicted to work with: Mouse, Rat, Horse, Chicken, Cow, Dog, Pig, Cynomolgus monkey;Clone#:ZAL13C2;Isotype:IgG1;Application:WB, Flow Cyt, IHC-P;Positive control:HepG2 lysate; Human adenocarcinoma of stomach, Human prostate, Human squamous cell carcinoma of esophagus and Human spleen tissues; PBMC and Jurkat cells.;Storage Buffer:Preservative: 0.05% Sodium azide Constituents: 0.05% BSA, 99% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;