Cat#:FPA-1053M;Product Name:Mouse Anti-Antithrombin III Monoclonal Antibody;Formulation:Liquid;Host Species:Mouse ;Immunogen:Full length native protein (purified) corresponding to Human Antithrombin III AA 33-464. (From Human plasma). Sequence: HGSPVDICTAKPRDIPMNPMCIYRSPEKKATEDEGSEQKIPEATNRRVWE LSKANSRFATTFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQ QLMEVFKFDTISEKTSDQIHFFFAKLNCRLYRK;Species Reactivity:Human Predicted to work with: Orangutan;Clone#:27EF671;Isotype:IgG1;Application:Sandwich ELISA;Storage Buffer:pH: 7.40 Preservative: 0.0975% Sodium azide Constituents: 0.81% Sodium chloride, 99% Phosphate Buffer;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. Store In the Dark.;