Cat#:FPA-10300M;Product Name:Mouse Anti-Hex Monoclonal Antibody;Formulation:Liquid;Host Species:Mouse ;Immunogen:Recombinant fragment corresponding to Human Hex AA 100-270. Expressed in E. coli. AAF04349.1 Sequence: LYPFPRTVNDYTHALLRHDPLGKPLLWSPFLQRPLHKRKGGQVRFSNDQT IELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQEN PQSNKKEELESLDSSCDQRQDLPSEQNKGASLDSSQCSPSPASQEDLESE;Species Reactivity:Human, Monkey Predicted to work with: Mouse;Clone#:2E3;Isotype:IgG2b;Application:ICC/IF, IHC-P;Positive control:Human skin tissue; COS7 cells transiently transfected by pCMV6-ENTRY Hex; HT29 and HeLa cells.;Storage Buffer:pH: 7.30 Preservative: 0.02% Sodium azide Constituents: 50% Glycerol, 1% BSA, 48% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;