• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Primary Antibodies >

Mouse Anti-Heme Oxygenase 1 Monoclonal Antibody Online Inquiry

Cat#:FPA-10185M
Product Name:Mouse Anti-Heme Oxygenase 1 Monoclonal Antibody
Formulation: Liquid
Host Species: Mouse
Immunogen: Synthetic peptide: MERPQPDSMPQDLSEALKEATKEVHTQAEN , corresponding to amino acids 1-30 of Human Heme Oxygenase 1.
Species Reactivity: Mouse, Rat, Cow, Dog, Human, Monkey Predicted to work with: Pig
Clone#: GN-1-1
Isotype: IgG1
Application: WB, ICC, Flow Cyt, ELISA, IP, Sandwich ELISA, IHC-P, ICC/IF, IHC-Fr
Positive control: Recombinant Human or Rat HO-1 (Hsp32) Protein. HEK293 treated with 30 uM hemin for 18hrs (see Abreview). IHC-P: FFPE human spleen normal.
Storage Buffer: Preservative: 0.09% Sodium Azide Constituents: 50% Glycerol, PBS
Storage Procedures: Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Online Inquiry

refresh