Cat#:FPA-10185M;Product Name:Mouse Anti-Heme Oxygenase 1 Monoclonal Antibody;Formulation:Liquid;Host Species:Mouse ;Immunogen:Synthetic peptide: MERPQPDSMPQDLSEALKEATKEVHTQAEN , corresponding to amino acids 1-30 of Human Heme Oxygenase 1. ;Species Reactivity:Mouse, Rat, Cow, Dog, Human, Monkey Predicted to work with: Pig;Clone#:GN-1-1;Isotype:IgG1;Application:WB, ICC, Flow Cyt, ELISA, IP, Sandwich ELISA, IHC-P, ICC/IF, IHC-Fr;Positive control:Recombinant Human or Rat HO-1 (Hsp32) Protein. HEK293 treated with 30 uM hemin for 18hrs (see Abreview). IHC-P: FFPE human spleen normal.;Storage Buffer:Preservative: 0.09% Sodium Azide Constituents: 50% Glycerol, PBS;Storage Procedures:Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.;