Cat#:FPA-069M;Product Name:Mouse Anti-5T4 Monoclonal Antibody;Formulation:5T4 is a 72 kDa transmembrane glycoprotein that exhibits restricted expression in human and mouse adult tissues, is upregulated on many carcinomas and tumour expression correlates with poorer clinical outcome in ovarian, gastric and colorectal cancers. mE;Host Species:Mouse ;Immunogen:Recombinant fragment corresponding to Human 5T4 AA 31-354. Sequence: SSSPTSSASSFSSSAPFLASAVSAQPPLPDQCPALCECSEAARTVKCVNR NLTEVPTDLPAYVRNLFLTGNQLAVLPAGAFARRPPLAELAALNLSGSRL DEVRAGAFEHLPSLRQLDLSHNPLADLSPFAFSGSNASVSAPSPLVELIL NHIVPPEDERQNRSFEGMVVAALLAGRALQGLR;Species Reactivity:Mouse, Human Predicted to work with: Cynomolgus monkey;Clone#:LL9534-6Z11;Isotype:IgG1;Application:IHC-P, Flow Cyt;Storage Buffer:Constituent: 100% PBS;Storage Procedures:Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.;