Cat#:RP-5913H;Product Name:Recombinant Streptavidin Protein;Background:Streptavidin is a 52.8 kDa protein purified from the bacterium Streptomyces avidinii. Streptavidin homo-tetramers have an extraordinarily high affinity for biotin (also known as vitamin B7 or vitamin H).Streptavidin is used extensively in molecular biology and bionanotechnology. The strong streptavidin-biotin bond can be used to attach various biomolecules to one another or onto a solid support.Pretargeted immunotherapy uses streptavidin conjugated to a monoclonal antibody against cancer cell-specific antigens followed by an injection of radiolabelled biotin to deliver the radiation only to the cancerous cell.;Description:Recombinant Streptavidin protein was produced in E.coli. The molecular weight per tetramer is approximately 52kDa.;Source:E.coli;AA Sequence:MAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLT GRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGA EARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS.;Purity:Greater than 98.0% as determined by SDS-PAGE and HPLC.;Formulation:Streptavidin recombinant protein was lyophilized in 10mM potassium phosphate buffer pH 6.5.;Stability:Recombinant Streptavidin proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:It is recommended to reconstitute the lyophilized Streptavidin in sterile 18M-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.;Storage:Recombinant Streptavidin protein is shipped at ambient temperature, upon arrival store at -20°C.;References:Weber, P. C. (1989). "Structural Origins of High-Affinity Biotin Binding to Streptavidin". Science. 243 (4887): 85–8. ;
Streptavidin is a 52.8 kDa protein purified from the bacterium Streptomyces avidinii. Streptavidin homo-tetramers have an extraordinarily high affinity for biotin (also known as vitamin B7 or vitamin H).Streptavidin is used extensively in molecular biology and bionanotechnology. The strong streptavidin-biotin bond can be used to attach various biomolecules to one another or onto a solid support.Pretargeted immunotherapy uses streptavidin conjugated to a monoclonal antibody against cancer cell-specific antigens followed by an injection of radiolabelled biotin to deliver the radiation only to the cancerous cell.
Description:
Recombinant Streptavidin protein was produced in E.coli. The molecular weight per tetramer is approximately 52kDa.
Greater than 98.0% as determined by SDS-PAGE and HPLC.
Formulation:
Streptavidin recombinant protein was lyophilized in 10mM potassium phosphate buffer pH 6.5.
Stability:
Recombinant Streptavidin proteins are stable for up to 1 year from date of receipt at -70℃
Reconstitution:
It is recommended to reconstitute the lyophilized Streptavidin in sterile 18M-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Storage:
Recombinant Streptavidin protein is shipped at ambient temperature, upon arrival store at -20°C.
References:
Weber, P. C. (1989). "Structural Origins of High-Affinity Biotin Binding to Streptavidin". Science. 243 (4887): 85–8.