• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Biological Fillers >

Recombinant Protein G Online Inquiry

Cat#:RP-5237H
Product Name:Recombinant Protein G
Description: Recombinant streptococcal protein G lacking the albumin binding region thereby avoiding undesirable reactions with albumin, though the Fc binding domain is still present. The recombinant Protein G is produced in Escherichia coli using sequence from Streptococcus C1-C2-C3. The Protein G contains 200 amino acids (190-384 and five additional residues not including methionine) having a molecular mass of 21.8kDa. The Protein-G migrates on SDS-PAGE around 32kDa.
Source: E.coli
AA Sequence: LPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDAT KTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFK QYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTL KGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE.
Purity: Greater than 96% as determined by SDS-PAGE and RP-HPLC.
Formulation: Lyophilized white powder containing no additives.
Stability: Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃
Reconstitution: Reconstitution with deionized water or PBS.

Online Inquiry

refresh