• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Rat Proteins >

Recombinant Rat Tpc1808 Protein Online Inquiry

  • Cat#:
  • RP-2400R
  • Product Name:
  • Recombinant Rat Tpc1808 Protein
  • Synonym:
  • Tropic 1808, Tpc1808.
  • Description:
  • Tropic-1808?Rat Recombinant protein fused to N-terminal His-Tag produced in E.coli is a single, non-glycosylated polypeptide chain containing 285 amino acids and having a molecular mass of 29.1 kDa. The Tpc1808 is purified by proprietary chromatographic techniques.
  • Source:
  • E.coli
  • AA Sequence:
  • MSYYHHHHHHMNLAQIAALNQISNLNAIRVGQVLKVSNAAGSNNTQNTTQPS AGVPTNTASSTTGYTVKSGDTLSAIAAANGVSLANLLSWNNLSLQAIIYPGQKL TIQNANNATVTTPNAPTSTPTVMPSTNGSYTVKSGDTLYGIAAKLGTNVQTLLS LNGLQLSSTIYVGQVLKTTGAVAGAGTATSTPTPVTPTVSKPAAANGVSTAGLS AAQAAWLRTAVVDAQAATAGTGVLASVTVAQAILESG
  • Purity:
  • >95.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
  • Formulation:
  • The Tropic-1808 was lyophilized from 1X PBS, pH 7.4.
  • Stability:
  • Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃
  • Storage:
  • Lyophilized Tpc1808 although stable 10°C for 1 week, should be stored desiccated below -18°C. Please prevent freeze-thaw cycles.
  • Pre product:Recombinant Rat TNF a Protein(His Tag)-Advanced Biomart
  • Online Inquiry

    refresh