Cat#:RP-200RL;Product Name:Recombinant Rat Leptin Protein;Synonym:Lep,leptin, OB, obese, obesity factor;Description:Rat Recombinant Leptin protein expressed in E.coli is a single, non-glycosylated, polypeptide chain containing 147aa and having a molecular weight of 16.3 kDa. The Leptin is purified by proprietary chromatographic techniques.;Source:E.coli;AA Sequence:MVPIHKVQDDTKTLIKTIVTRINDISHTQSVSARQRVTGLDFIPGLHPILSLSKMDQTLA VYQQILTSLPSQNVLQIAHDLENLRDLLHLLAFSKSCSLPQTRGLQKPESLDGVLEASLY STEVVALSRLQGSLQDILQQLDLSPEC;Molecular Characterization:16.3 kDa;Purity:Greater than 95% as analyzed by SDS-PAGE and HPLC.;Endotoxin:< 0.2 EU/μg of rat leptin protein as determined by LAL method.;Bioactivity:ED50 < 10 µg/mL, measured by a cell proliferation assay using LoVo cells, corresponding to a specific activity of > 100 units/mg.;Formulation:Recombinant rat leptin protein was lyophilized after extensive dialysis against 50 mM Tris, pH8.0.;Stability:Recombinant rat leptin proteins are stable for up to 1 year from date of receipt at -70℃;Host Species:Rat;Storage:Store the lyophilized recombinant rat Leptin at -20°C from date of receipt. Upon reconstitution, rat Leptin protein remains stable up to 2 weeks at 4°C or up to 3 months at -20°C. Please avoid freeze-thaw cycles.;Usage:For Lab Research Use Only;References:Differential physiological responses to central leptin overexpression in male and female rats. Côté I, et al. J Neuroendocrinol, 2017 Dec. PMID 29044801;
Rat Recombinant Leptin protein expressed in E.coli is a single, non-glycosylated, polypeptide chain containing 147aa and having a molecular weight of 16.3 kDa. The Leptin is purified by proprietary chromatographic techniques.
Greater than 95% as analyzed by SDS-PAGE and HPLC.
Endotoxin:
< 0.2 EU/μg of rat leptin protein as determined by LAL method.
Bioactivity:
ED50 < 10 µg/mL, measured by a cell proliferation assay using LoVo cells, corresponding to a specific activity of > 100 units/mg.
Formulation:
Recombinant rat leptin protein was lyophilized after extensive dialysis against 50 mM Tris, pH8.0.
Stability:
Recombinant rat leptin proteins are stable for up to 1 year from date of receipt at -70℃
Host Species:
Rat
Usage:
For Lab Research Use Only
Storage:
Store the lyophilized recombinant rat Leptin at -20°C from date of receipt. Upon reconstitution, rat Leptin protein remains stable up to 2 weeks at 4°C or up to 3 months at -20°C. Please avoid freeze-thaw cycles.
References:
Differential physiological responses to central leptin overexpression in male and female rats. Côté I, et al. J Neuroendocrinol, 2017 Dec. PMID 29044801