Cat#:RP-2331R;Product Name:Recombinant Rat IL1 beta Protein;Synonym:Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.;Description:Interleukin-1b Rat Recombinant produced in E.coli is a non-glycosylated, Polypeptide chain containing 153 amino acids and having a molecular mass of 17.3 kDa. The IL-1b is purified by proprietary chromatographic techniques.;Source:E.coli;AA Sequence:MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSF VQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKK KMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRD IVDFTMEPVSS.;Purity:>97.0% as determined by SDS-PAGE.;Bioactivity:The ED50 was found to be less than 0.1ng/ml, determined by the dose dependent proliferation of mouse D10S cells, corresponding to a specific activity of 10,000,000 units/mg.;Formulation:The protein was lyophilized from 0.2um filtered concentrated solution in PBS, pH 7.4.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:It is recommended to reconstitute the lyophilized Interleukin 1b in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.;Storage:Lyophilized Interleukin-1b although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL1b should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.;