Cat#:RP-2387R;Product Name:Recombinant Rat RAP Protein;Synonym:Receptor Associated Protein, RAP.;Description:Recombinant Rat Receptor Associated Protein produced in E.coli is a single, non-glycosylated polypeptide chain containing 327 amino acids and having a molecular mass of 38,862 Dalton. The Recombinant RAP Rat contains 6xHis tag and 1xC-myc, RAP Rat is purified by proprietary chromatographic techniques.;Source:E.coli;AA Sequence:MAPLRDRVSTLPRLQLLVLLLLPLLLVPQPIAGHGGKYSREKNEPEMAAKRESGEEFRME KLNQLWEKAKRLHLSPVRLAELHSDLKIQERDELNWKKLKVEGLDGDGEKEAKLVHNLNV ILARYGLDGRKDTQTVHSNALNEDTQDELGDPRLEKLWHKAKTSGKFSSEELDKLWREFL HYKEKIHEYNVLLDTLSRAEEGYENLLSPSDMTHIKSDTLASKHSELKDRLRSINQGLDR LRKVSHQGYGP;Purity:>95.0% as determined by SDS-PAGE.;Formulation:The protein (1mg/ml) was lyophilized after from a sterile solution containing TBS pH-7.5, 0.1% BSA and 0.09% NaN3.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:It is recommended to reconstitute the lyophilized RAP Rat in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.;Storage:Lyophilized RAP Rat although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution RAP Rat should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.;