Cat#:RP-2288R;Product Name:Recombinant Rat CNTF Protein;Synonym:HCNTF, CNTF, Ciliary Neurotrophic Factor.;Description:CNTF Recombinant Rat produced in E.coli is a single, non-glycosylated polypeptide chain containing 200 amino acids and having a molecular mass of 22834 Dalton. The CNTF is purified by proprietary chromatographic techniques.;Source:E.coli;AA Sequence:AFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNI NLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRV HFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPA TVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESH YGAKDKQM.;Purity:>99.0% as determined by: (a) Analysis by Gel Filtration. (b) Analysis by SDS-PAGE.;Bioactivity:Fully biologically active by its ability to phosphorylate STAT3 in several cells lines.;Formulation:Lyophilized from a concentrated (1mg/ml) solution in water containing 0.025% NaHCO3.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:It is recommended to reconstitute the lyophilized CNTF in sterile water or 0.4% NaHCO3 adjusted to pH 8-9, not less than 100µg/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein.;Storage:Lyophilized CNTF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CNTF should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.;