Cat#:RP-1837M;Product Name:Recombinant Mouse IL17F Protein;Synonym:Cytokine ML-1, IL-17F, Interleukin-17F precursor, IL17F, ML1, ML-1.;Description:IL17F Mouse Recombinant produced in E.coli is a homodimeric, non-glycosylated polypeptide chain containing a total of 266 amino acids and having a molecular mass of 29.8 kDa. The Mouse IL-17F is purified by proprietary chromatographic techniques.;Source:E.coli;AA Sequence:RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSP WDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRR EPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA.;Purity:Greater than 97.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.;Bioactivity:Please contact us for detailed information;Formulation:IL17F was lyophilized from a concentrated (1mg/ml) solution containing no additives.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:It is recommended to reconstitute the lyophilized Mouse IL17F in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.;Storage:Lyophilized Murine IL17F although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17F should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.;