Cat#: | RP-009MS |
Product Name: | Recombinant Mouse Rhox5 Protein, GST Tag |
Source: | E. coli |
AA Sequence: | MEAEGSSRKVTRLLRLGVKEDSEEQHDVKAEAFFQAGEGRDEQGAQGQPGVGAVGTEGEGEELNGGKGHFGPGAPGPMGDGDKDSGTRAGGVEQEQNEPVAEGTES |
Purity: | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Formulation: | Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 100 mM GSH, pH 8.0) and 10% glycerol. |
Stability: | Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃ |
Reconstitution: | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. |
Storage: | Short-term storage: Store at 2-8°C for two weeks. Long-term storage: Aliquot and store at -20°C to -80°C for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |