• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Mouse Proteins >

Recombinant Mouse Unc119b Protein, GST Tag Online Inquiry

Cat#:RP-002MS
Product Name:Recombinant Mouse Unc119b Protein, GST Tag
Source: E. coli
AA Sequence: MSGSNPKAAAAASAAGPGGLVAGKEEKKKAGGGVLNRLKARRQAPHHAADDGVGAAVTEQELLALDTIRPEHVLRLSRVTENYLCKPEDNIYSIDFTRFKIRDLETGTVLFEIAKPCVSDQEEDEEEGGGDVDISAGRFVRYQFTPAFLRLRTVGATVEFTVGDKPVSNFRMIERHYFREHLLKNFDFDFGFCIPSSRNTCEHIYEFPQLSEDVIRLMIENPYETRSDSFYFVDNKLIMHNKADYAYNGGQ
Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Formulation: Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 100 mM GSH, pH 8.0) and 10% glycerol.
Stability: Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃
Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Storage: Short-term storage: Store at 2-8°C for two weeks. Long-term storage: Aliquot and store at -20°C to -80°C for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
  • Pre product:Recombinant Mouse Abhd5 Protein, GST Tag-Advanced Biomart
  • Online Inquiry

    refresh