Recombinant Human WNV Pre-M Online Inquiry

• Cat#:
• RP-6469H

• Product Name:
• Recombinant Human WNV Pre-M

• Description:
• The E.coli derived 20kda recombinant protein contains the West-Nile N-Terminal Pre-M Virus immunodominant regions. The protein is fused with 6xHis tag.

• Source:
• E.coli

• AA Sequence:
• MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVR YGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTK ATRYLVKTESWILRNPGYALE.

• Purity:
• Protein is Greater than 95% pure as determined by SDS-PAGE.

• Formulation:
• 20mM phosphate buffer pH 7.5.

• Stability:
• Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃

• Storage:
• WNV Pre-M although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.