• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human VEGI Protein Online Inquiry

  • Cat#:
  • RP-6428H
  • Product Name:
  • Recombinant Human VEGI Protein
  • Synonym:
  • Tumor necrosis factor ligand superfamily member 15, TNFSF-15, TNFSF15, TNF ligand-related molecule 1, VEGI, TL-1, TL1, TL1A, VEGI192A, VEGI-192, MGC129934, MGC129935.
  • Description:
  • TNFSF15 Protein produced in E.coli is a single, non-glycosylated, polypeptide chain containing 180 amino acids and having a molecular mass of 20.5kDa. The TNFSF15 is purified by proprietary chromatographic techniques.
  • Source:
  • E.coli
  • AA Sequence:
  • MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHL TVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKF LLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSIT VVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAM FSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL.
  • Purity:
  • Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
  • Bioactivity:
  • The ED50 as determined by its ability to induce apoptosis using human TF-1 cells is less than 20ng/ml, corresponding to a specific activity of > 5.0×104 IU/mg.
  • Formulation:
  • The TNFSF15 was lyophilized from a 0.2µm filtered concentrated solution in PBS, pH 7.4 with 0.02% Tween-20.
  • Stability:
  • Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃
  • Reconstitution:
  • It is recommended to reconstitute the lyophilized TNFSF15 in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
  • Storage:
  • TNFSF15 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution VEGI should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
  • Pre product:Recombinant Human VEGFR2 Protein-Advanced Biomart
  • Online Inquiry

    refresh