Cat#:RP-6409H;Product Name:Recombinant Human VDR Protein;Synonym:Vitamin D3 receptor, VDR, 1,25-dihydroxyvitamin D3 receptor, Nuclear receptor subfamily 1 group I member 1, VDR, NR1I1.;Description:Vitamin D Receptor Protein produced in E.coli is a full length protein consisting of 427 amino acids having a molecular weight of 48.3kDa and fused with 5.5kDa amino-terminal His-Flag tag. VDR is purified by proprietary chromatographic techniques.;Source:E.coli;AA Sequence:MSYYHHHHHHDYDIPTTDYKDDDDKDYKDDDDKENLYF QGEFMEAMAASTSLPDPGDFDRNVPRICGVCGDRATGF HFNAMTCEGCKGFFRRSMKRKALFTCPFNGDCRITKDNR RHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEE EALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFR PPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITS SDMMDSSSFSNLDL;Purity:Greater than 70.0% as determined by SDS-PAGE.;Formulation:VDR protein is supplied in 50mM Tris, 150mM NaCl and 10% Glycerol, pH 7.5.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Storage:Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.;