Cat#:RP-6276H;Product Name:Recombinant Human TXN1 Protein;Synonym:Thioredoxin-1, Trx-1, trxA, fipA, tsnC, b3781, JW5856.;Description:Recombinant Thioredoxin was purified from E. coli harboring its gene.;Source:E.coli;AA Sequence:HMSDKIIHL TDDSFDTDVLKADGAIL VDFW AEWCGPCKMIAPILDEI GKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGAL DANLA.;Purity:Greater than 90.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.;Bioactivity:TRX activity is assayed by measuring the change in absorbance at 650 nm at 25°C using 0.13µM bovine insulin containing 0.33mM DTT (pH 6.5). The specific activity was found to be 3IU/mg.;Formulation:Each mg of protein contains 20mM phosphate buffer pH 7.4.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:It is recommended to reconstitute the lyophilized TRX in sterile 18MΩ-cm H2O.;Storage:TRX although stable at 4°C for 3 weeks, should be stored desiccated below -18°C. Please prevent freeze thaw cycles.;