Cat#:RP-6172H;Product Name:Recombinant Human TNNI3 Protein;Synonym:Troponin I cardiac muscle, Cardiac troponin I, TNNI3, TNNC1, CMH7, RCM1, cTnI, CMD2A, MGC116817.;Description:Recombinant Human TNNI3 produced in E.coli is a single, non-glycosylated, polypeptide chain containing?210 amino acids and having a molecular mass of 24,016 Dalton. The TNNI3 is purified by proprietary chromatographic techniques.;Source:E.coli;AA Sequence:MADGSSDAAREPRPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLKTLLLQ IAKQELEREAEERRGEKGRALSTRCQPLELAGLGFAELQDLCRQLHARVDKVDEE RYDIEAKVTKNITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKE SLDLRAHLKQVKKEDTEKENREVGDWRKNIDALSGMEGRKKKFES.;Purity:Greater than 98.0% as determined by both: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.;Formulation:TNNI3 solution containing 6M Urea 50mM Tris PH 8.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Storage:Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze-thaw cycles.;