• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human TNNI3 Protein Online Inquiry

  • Cat#:
  • RP-6172H
  • Product Name:
  • Recombinant Human TNNI3 Protein
  • Synonym:
  • Troponin I cardiac muscle, Cardiac troponin I, TNNI3, TNNC1, CMH7, RCM1, cTnI, CMD2A, MGC116817.
  • Description:
  • Recombinant Human TNNI3 produced in E.coli is a single, non-glycosylated, polypeptide chain containing?210 amino acids and having a molecular mass of 24,016 Dalton. The TNNI3 is purified by proprietary chromatographic techniques.
  • Source:
  • E.coli
  • AA Sequence:
  • MADGSSDAAREPRPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLKTLLLQ IAKQELEREAEERRGEKGRALSTRCQPLELAGLGFAELQDLCRQLHARVDKVDEE RYDIEAKVTKNITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKE SLDLRAHLKQVKKEDTEKENREVGDWRKNIDALSGMEGRKKKFES.
  • Purity:
  • Greater than 98.0% as determined by both: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
  • Formulation:
  • TNNI3 solution containing 6M Urea 50mM Tris PH 8.
  • Stability:
  • Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃
  • Storage:
  • Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze-thaw cycles.
  • Pre product:Recombinant Human TNNI2 Protein(His Tag)-Advanced Biomart
  • Online Inquiry

    refresh