Cat#:RP-5954H;Product Name:Recombinant Human SYK Protein;Synonym:Tyrosine-protein kinase SYK, Spleen tyrosine kinase, p72-Syk, SYK.;Description:SYK Protein full length protein (1-635 aa) produced in HEK 293 cells with an N-terminal His-Flag tag, having a molecular weight of 74.25kDa. Human SYK is purified by proprietary chromatographic techniques.;Source:HEK 293 cells.;AA Sequence:MHHHHHHDYKDDDDKKLMASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGL YLLRQSRNYLGGFALSVAHGRKAHHYTIERELNGTYAIAGGRTHASPADLCHYHSQES DGLVCLLKKPFNRPQGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQL EKLIATTAHEKMPWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKV LHYRIDKDKTGKLSIPEGKKF;Purity:Greater than 85.0% as determined by SDS-PAGE.;Formulation:SYK protein is supplied in 50mM Tris pH 7.5, 300mM NaCl and 10% Glycerol.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Storage:Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.;