Cat#:RP-5944H;Product Name:Recombinant Human SUMO2 Protein;Synonym:Small ubiquitin-related modifier 2, SUMO-2, Ubiquitin-like protein SMT3B, SMT3 homolog 2, Sentrin-2, HSMT3, SUMO-3, SUMO2, SMT3B, SMT3H2, MGC117191.;Description:SUMO2 Protein produced in E.coli is a single, non-glycosylated polypeptide chain containing 93 amino acids and having a molecular mass of 10.6 kDa. The SUMO-2 is purified by proprietary chromatographic techniques.;Source:E.coli;AA Sequence:MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYC ERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG.;Purity:Greater than 95.0% as determined by SDS-PAGE.;Formulation:The SUMO2 (1mg/ml) containing 20mM Tris-HCl buffer (pH 8.0).;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Storage:Can be stored at +4C for 1 week. For long term storage , below -20C. Please prevent freeze-thaw cycles.;