Cat#:RP-5836H;Product Name:Recombinant Human SPARC Protein;Synonym:Osteonectin, ON, Basement-membrane protein 40, BM-40, SPARC, Secreted Protein acidic and Rich in Cysteine.;Description:Osteonectin Protein fused with 6X His tag produced in E.coli is a single, non-glycosylated, polypeptide chain containing 295 amino acids and having a molecular mass of 34 kDa. The BM40 is purified by proprietary chromatographic techniques.;Source:E.coli;AA Sequence:MSYYHHHHHHPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFD DGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCP APIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCK YIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTKQKLRVKKI HENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGY LSHTELAPLRAPL;Purity:Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.;Formulation:The SPARC (1 mg/ml) was lyophilized after extensive dialyses against 20mM PBS pH-7.4.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Reconstitution:It is recommended to reconstitute the lyophilized SPARC in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.;Storage:Lyophilized Osteonectin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BM-40 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.;