• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human RORC Protein Online Inquiry

  • Cat#:
  • RP-5492H
  • Product Name:
  • Recombinant Human RORC Protein
  • Synonym:
  • Nuclear receptor ROR-gamma, Nuclear receptor RZR-gamma, Nuclear receptor subfamily 1 group F member 3, Retinoid-related orphan receptor-gamma, RORC, NR1F3, RORG, RZRG, TOR, RZR-GAMMA.
  • Description:
  • RAR-Related Orphan Receptor C Protein produced in E.coli is a full length protein consisting of 497 amino acids having a molecular weight of 55.8kDa and fused with 5.5kDa amino-terminal His-Flag tag. RORC is purified by proprietary chromatographic techniques.
  • Source:
  • E.coli
  • AA Sequence:
  • MSYYHHHHHHDYDIPTTDYKDDDDKDYKDDDDKENLYFQGEF MRTQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAY SCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMS KKQRDSLHAEVQKQLQQRQQQQQEPVVKTPPAGAQGADTLT YTLGLPDGQLPLGSSPDLPEASACPPGLLKASGSGPSYSNNLA KAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRC
  • Purity:
  • Greater than 80.0% as determined by SDS-PAGE.
  • Formulation:
  • RORC protein is supplied in 50mM Tris, 150mM NaCl and 10% Glycerol, pH 7.5.
  • Stability:
  • Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃
  • Storage:
  • Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.
  • Pre product:Recombinant Human ROBLD3 Protein-Advanced Biomart
  • Online Inquiry

    refresh