Cat#:RPH-NP337;Product Name:Recombinant Human Resistin / RETN / ADSF Protein;Synonym:Resistin, Adipose tissue-specific secretory factor, Cysteine-rich secreted protein FIZZ3, C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein, Cysteine-rich secreted protein A12-alpha-like 2, FIZZ3, HXCP1, RSTN, RETN;Description:Recombinant Human Resistin Protein is produced in E.coli and the target gene encoding Lys19-Pro108 is expressed with a His tag at the C-terminus.;Source:E. coli;AA Sequence:KTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDV RAETTCHCQCAGMDWTGARCCRVQPLEHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Resistin/RETN/ADSF Protein was lyophilized from a 0.2 μm filtered solution of 20mM Acetic acid,pH 3.0.;Stability:Recombinant Human Resistin/RETN/ADSF Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human Resistin protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human Resistin protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human Resistin protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;