Cat#:RP-5375H;Product Name:Recombinant Human RAC1 Protein;Synonym:P21-RAC1, RAC-1, RAC1, RAS-like protein TC25, MIG5, Cell-migration-inducing gene 5 protein,Ras-related C3 botulinum toxin substrate 1, rho family small GTP binding protein Rac1, TC-25, MGC111543.;Description:Ras-Related C3 Botulinum Toxin substrate 1 Protein produced in E.coli is a single, non-glycosylated polypeptide chain containing 192 amino acids and having a molecular mass of 21.4 kDa.;Source:E.coli;AA Sequence:MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVN LGLWDTAQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRH HCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLE CSALTQRGLKTVFDEAIRAVLCP PPVKKRKRKCLLL.;Purity:Greater than 95.0% as determined by SDS-PAGE.;Formulation:The protein solution contains 20mM Tris-HCl pH7.5, 2mM EDTA and 1mM DTT.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Storage:Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze-thaw cycles.;