Cat#:RPH-NP332;Product Name:Recombinant Human Prostaglandin-H2 D-Isomerase / PTGDS Protein;Synonym:Prostaglandin-H2 D-Isomerase, Beta-Trace Protein, Cerebrin-28, Glutathione-Independent PGD Synthase, Lipocalin-Type Prostaglandin-D Synthase, Prostaglandin-D2 Synthase, PGD2 Synthase,PGDS, PGDS2, PTGDS, PDS;Description:Recombinant Human Prostaglandin-D2 Synthase Protein is produced in Human Cells and the target gene encoding Ala23-Gln190 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:APEAQVSVQPNFQQDKFLGRWFSAGLASNSSWLREKKAALSMCKSVVAPATDGGLNLTSTFLRKN QCETRTMLLQPAGSLGSYSYRSPHWGSTYSVSVVETDYDQYALLYSQGSKGPGEDFRMATLYSRT QTPRAELKEKFTAFCKAQGFTEDTIVFLPQTDKCMTEQVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Prostaglandin-H2 D-Isomerase/PTGDS Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,10%Glycerol,pH7.5.;Stability:Recombinant Human Prostaglandin-H2 D-Isomerase/PTGDS Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Prostaglandin-H2 D-Isomerase/PTGDS Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;