• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human ProNGF Protein Online Inquiry

  • Cat#:
  • RP-5230H
  • Product Name:
  • Recombinant Human ProNGF Protein
  • Synonym:
  • Human Pro-NGF, ProNGF, NGFB.
  • Description:
  • Pro NGF is the pro-form of the neurotrophin nerve growth factor. Like the mature protein pro NGF is characterized by the cysteine knot motif consisting of three cysteine bridges. The protein predominantly exists as a non-covalently linked homodimer.Pro-Nerve Growth Factor Protein produced in E.coli is a non-glycosylated, polypeptide chain containing 224 amino acids and having a molecular mass of 50KDa.The Pro NGF is purified by proprietary chromatographic techniques.
  • Source:
  • E.coli
  • AA Sequence:
  • MEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNI TVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRS SSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFET KCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTAC VCVLSRKAVRRA.
  • Purity:
  • Greater than 95.0% as determined by SDS-PAGE.
  • Formulation:
  • ProNGF was lyophilized from a 0.2 µM filtered solution of 20mM PB and 250mM NaCl pH 7.2.
  • Stability:
  • Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃
  • Reconstitution:
  • It is recommended to reconstitute the lyophilized ProNGF in 1xPBS to a concentration no less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
  • Storage:
  • Lyophilized ProNGF although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution ProNGF should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles.
  • Pre product:Recombinant Human ProMMP 9 Protein-Advanced Biomart
  • Online Inquiry

    refresh