Cat#:RP-5219H;Product Name:Recombinant Human PROC Protein;Synonym:Vitamin K-dependent protein C, Anticoagulant protein C, Autoprothrombin IIA, Blood coagulation factor XIV, PROC, PC, APC, PROC1, THPH3, THPH4.;Description:PROC Protein full length protein (33-461 aa) produced in HEK 293 cells with a C-terminal His-tag, having a molecular weight of 72kDa. Human PROC is purified by proprietary chromatographic techniques.;Source:HEK 293 cells.;AA Sequence:MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERE CIEEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIG SFSCDCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGD DLLQCHPAVKFPCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPW QVVLLDSKKKLACGAVLIHPSWVLTA;Purity:Greater than 80.0% as determined by SDS-PAGE.;Formulation:PROC protein is supplied in 50mM Tris pH 7.5, 300mM NaCl and 10% Glycerol.;Stability:Recombinant Proteins are stable for up to 1 year from date of receipt at -70℃;Storage:Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.;